LL-37 Suppliers, LL-37 Manufacturers.
GenicBio Limited
LL-37
Category :
Other ChemicalsSynonyms :
H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH;antibacterial protein LL-37 amide;LL-37(human);CAS NO :
154947-66-7EC NO :
Molecular Formula :
Molecular Weight :
Main Specifications :
Packing :
1mg,5mg,10mg,25mg,100mg,1g,10gProduct description :
[LL-37, 37 aa]
World Wide ChemNet: - International - China - Korea
About Us - Top Products- Partner with Us - Contact Us - Help - Sitemap
About Us - Top Products- Partner with Us - Contact Us - Help - Sitemap
ChemNet is a registered trademark of Zhejiang NetSun Co., Ltd.
